Protein Info for DVU0451 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: chloride channel family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 257 to 274 (18 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details amino acids 421 to 438 (18 residues), see Phobius details PF00654: Voltage_CLC" amino acids 93 to 439 (347 residues), 308.5 bits, see alignment E=6.4e-96 PF00571: CBS" amino acids 538 to 594 (57 residues), 34.4 bits, see alignment 2.2e-12

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to dvu:DVU0451)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EW7 at UniProt or InterPro

Protein Sequence (603 amino acids)

>DVU0451 chloride channel family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLRILATPWREFARLYSSVAFVRLAVLGIGLGVVSGCAAMLFFLGIEYAKHLILVAWAGL
SLPAPAGEGLFHDAAAGGAYRPWVIPLATCATGLVTGWLVQRFLPDSLAGMTDGTDAMIR
AFHRGKGVIRKRAPFIKGLTSILTIASGGSAGREGPISQIGAGLGSFVADRLHLSTKERR
LLMLAGAAGGLGAVFRAPLGGALTAIEVVYREDFEAEAMLPAILSSVVAYTLFAYVFGTE
PMFAIPRFSFSDMRELPFYLTLALACAFTGWAYVRTFRFMKYGVFLRLAERVGIMWTTAL
GGLLVGLFGIIYTPMLSDGYGWVEQAILGHLTVTTMVTIMVAKTLATAMTLGSGMSGGMF
APALFVGGMTGGVVGYAAHDLFPHIVREPGGYVLVGMAAFFAGVAHAPVGPLIMVCELTQ
GYGLLAPLMLASAVCILLNRKVSLYENQVENKFESPAHASDATVNLLEGLTVRECFHRGR
VPTLEEGTTLKALTDVIAGTSVFTFPVRDASGALSGILAVQDVRALLYEESLFDLVVVRD
LMRPLLTLAESDDLYAALLRFVDTDLSHIIVVDDDDREKVLGLLYRADLFKAYSDALRIA
RED