Protein Info for DVU0446 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sodium/solute symporter family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details amino acids 328 to 356 (29 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 473 to 491 (19 residues), see Phobius details PF00474: SSF" amino acids 43 to 442 (400 residues), 356.2 bits, see alignment E=1.2e-110 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 43 to 442 (400 residues), 185.8 bits, see alignment E=7.2e-59

Best Hits

Swiss-Prot: 62% identical to ACTP_CITK8: Cation/acetate symporter ActP (actP) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to dvl:Dvul_2490)

MetaCyc: 62% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EX2 at UniProt or InterPro

Protein Sequence (515 amino acids)

>DVU0446 sodium/solute symporter family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPEFTSTLGQPNAVSILFFFAFVAFTLAITWFAARRSRSASEFYAAGRSVTGLQNGLALA
GDYMSAASFLGIAGLVSLKGYDGLIYSIGFLVGWPLMMFLIAEPLRNLGRYTFADVVAYR
LRQKPIRIAAACGSLMTVCFYLIAQMVGSGALVQLMFGIRYEYAVVAVGFIMMAYVLFGG
MLATTWVQITKAVLLLGGATAMVVMVLAQFDYSPTRLFVTAAAKHGEAMLAPGGLVSNPW
DAISLGMALMFGTAGLPHILMRFYTVPDARAARKSVFYATGLISYFYVLTFIIGFGAMML
VGPDAIRMFDKGGNMAAPLLAEVTGGTMFLGFIAAVAFATILAVVAGLTLAGATTFSHDL
YANVFKGGQSNEADEVRVAKRATIALGVIAMLLGIAFKGQNVAFMVGLAFAIAASANLPA
LLLSIMWRGCSTTGAVWAIVTGGVLAVGLIIVSPTVWTDVFHLGTAPFPLKNPALLSMPA
AFMAGIAGSLLRPDSEESARFDAQKIRNYLGVGAE