Protein Info for DVU0434 in Desulfovibrio vulgaris Hildenborough JW710

Name: mnhA
Annotation: Ech hydrogenase, subunit EchA, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 54 (24 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 165 to 181 (17 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 320 to 346 (27 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 423 to 446 (24 residues), see Phobius details amino acids 458 to 480 (23 residues), see Phobius details amino acids 503 to 525 (23 residues), see Phobius details amino acids 548 to 572 (25 residues), see Phobius details amino acids 629 to 647 (19 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 119 to 154 (36 residues), 41.4 bits, see alignment 1.1e-14 PF00361: Proton_antipo_M" amino acids 182 to 470 (289 residues), 182.8 bits, see alignment E=8.8e-58

Best Hits

KEGG orthology group: K05903, NADH dehydrogenase (quinone) [EC: 1.6.99.5] (inferred from 100% identity to dvl:Dvul_2501)

Predicted SEED Role

"Energy-conserving hydrogenase (ferredoxin), subunit A" in subsystem Energy-conserving hydrogenase (ferredoxin) or NiFe hydrogenase maturation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EY4 at UniProt or InterPro

Protein Sequence (648 amino acids)

>DVU0434 Ech hydrogenase, subunit EchA, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLDTLVFGCVAFPLLAALAVYFVRGEAARRLIVPGAVAVTALSALGMAGSGPIMFAPKSF
LGIGLDGLIAFLDFALLFYILYLGTKMRHLLIMGMTVLQIVGLIYLEFFLMDHGATVPGF
YVDSLSLTMVLIISFVGGLICVYGLGYMKEHEEHLHLPQTKQPRFFFFVVLFLGAMNGLV
LSNNLAWMYFFWEITTLCSFMLIGHDGTDEAKTNATRALWMNMVGGVAFVFALLFLQKGM
GTLSVQDILARAVEPEMRTTAVLLPMAMLCLAGFTKSAQLPFQSWLCGAMVAPTPVSALL
HSSTMVKAGVYLILRMAPGYAGTALSTGVALFGAFTFIVTSALAAGQSNGKKILAYSTIA
NLGLIVACAGINTAASVAAAMMLIIFHAISKGLLFLCVGAIEQKIGSRNIEDMRNLFERM
PRTAVITVIGIVTMMLPPFGMLIAKWMAIESAAGAMSAMPLLVIMIALGSALTVLFWARW
AGIMLGSSRPGFGPMQEEQDITIRLPLVSLVGGALVLSLLAPFVYTGLVEPAIAMYAKAS
AYGVSIGTIGNTMGAFAVYPLYLLLGAGFYYAWRAARNTPDSAASLPYMGGSQMTQDGVV
GFNGPMNQFVPNAAGNYYLEKLFGEAQLTKPGNVVAIVLLILMIGGML