Protein Info for DVU0431 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Ech hydrogenase, subunit EchD, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00329: Complex1_30kDa
  • amino acids 21 to 114 (94 residues), 39.8 bits, E=3.2e-14

Best Hits

KEGG orthology group: K14089, ech hydrogenase subunit D (inferred from 100% identity to dvu:DVU0431)

MetaCyc: 35% identical to Ech hydrogenase 15 kDa subunit (Methanosarcina barkeri)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Energy-conserving hydrogenase (ferredoxin), subunit D" in subsystem Energy-conserving hydrogenase (ferredoxin)

MetaCyc Pathways

• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

See Q72EY7 at UniProt or InterPro

Protein Sequence (130 amino acids)

>DVU0431 Ech hydrogenase, subunit EchD, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPNHTEILNAKPIAIDAIVGEAKALFEQDYRLVTYSVVDLGDGNVDIIYHFDKDLEFVHY
RLTTPKDQPIPSLTPVYFAALLIENEARDQFGLTFDGLVLDFNRTLYLDDEITGSMSAPF
CKISTIQKKA