Protein Info for DVU0430 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Ech hydrogenase, subunit EchE, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 108 to 128 (21 residues), see Phobius details PF00374: NiFeSe_Hases" amino acids 42 to 110 (69 residues), 45.7 bits, see alignment E=5e-16 PF00346: Complex1_49kDa" amino acids 119 to 281 (163 residues), 143.9 bits, see alignment E=5.3e-46 amino acids 285 to 358 (74 residues), 57.7 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 36% identical to Y515_METJA: Uncharacterized protein MJ0515 (MJ0515) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00329, NADH dehydrogenase [EC: 1.6.5.3] (inferred from 100% identity to dvl:Dvul_2505)

MetaCyc: 54% identical to Ech hydrogenase 39 kDa subunit (Methanosarcina barkeri)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Energy-conserving hydrogenase (ferredoxin), subunit E" in subsystem Energy-conserving hydrogenase (ferredoxin)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2, 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EY8 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DVU0430 Ech hydrogenase, subunit EchE, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRTIIPFGPQHPVLPEPLHLKLVVEDETVVEAIPALGYVHRGLETLASIRDYNQMVYVV
ERVCGICSCIHAMCYCQSLECMMNVEVPRRAKVLRTIWSELHRIHSHLLWLGLFADGFGF
ESLFMQFWKVRERVMDINEATAGNRVVISTNIVGGVRRDLSPEHQKWILDEMNHLEREIR
ALMTTILDDYTVCKRTKGVGVLTAQQAIQLGAVGPMLRGSGVAQDARQLQYAAFDELDFE
PIAVPDGDSWARCKVRFLEVLQSVDLVRQAISKLPDTELSVKVPGKPEGEVVARVEQPRG
ELMYYVKGNGSKHLERVRIRTPTFANIPPLLAIMGGLQLADVPVAVLSIDPCISCTER