Protein Info for DVU0419 in Desulfovibrio vulgaris Hildenborough JW710

Name: nspC
Annotation: carboxynorspermidine decarboxylase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR01047: carboxynorspermidine decarboxylase" amino acids 16 to 389 (374 residues), 482.8 bits, see alignment E=2.5e-149 PF00278: Orn_DAP_Arg_deC" amino acids 88 to 345 (258 residues), 46 bits, see alignment E=2.7e-16

Best Hits

KEGG orthology group: K13747, carboxynorspermidine decarboxylase [EC: 4.1.1.-] (inferred from 100% identity to dvu:DVU0419)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EZ9 at UniProt or InterPro

Protein Sequence (390 amino acids)

>DVU0419 carboxynorspermidine decarboxylase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMDERYLAALDPARFPSPCFVIDEDRLVANAAILDEVQRRTGARVLLALKGFAAWSTFPL
LSRAQGGVLHGTCASSPHEARLGRETFGGEVHAFAAGYSEDDMAELVTIADHIVFNSFAQ
WRRYRPVVEASGRHIECGIRVNPEHSEGAVAIYNPCSPGSRLGVRERHFEPQSLEGITGL
HFHTLCEQDAGALSRTLDAFESKFGRYLEGMRWVNFGGGHHITREGYDLDLLCRCIERIR
DRYGVQVYIEPGEAVALDAGVLLCSVLDVVQADVPVVILDTSAAAHMPDVLEMPYRPGCI
GSGLPDEKAWTCRLAGKSCLAGDVVGDYSFDRPLRPGDRLAFLDMAIYSMVKTTTFNGLQ
LPAIALYRASSGKREVVRTFGYETFRDRLS