Protein Info for DVU0418 in Desulfovibrio vulgaris Hildenborough JW710

Name: lys1
Annotation: saccharopine dehydrogenase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03435: Sacchrp_dh_NADP" amino acids 4 to 137 (134 residues), 129.4 bits, see alignment E=1.1e-41 PF16653: Sacchrp_dh_C" amino acids 141 to 389 (249 residues), 150.9 bits, see alignment E=7.1e-48

Best Hits

KEGG orthology group: K00290, saccharopine dehydrogenase (NAD+, L-lysine forming) [EC: 1.5.1.7] (inferred from 100% identity to dvl:Dvul_2516)

MetaCyc: 64% identical to carboxyspermidine dehydrogenase (Campylobacter jejuni jejuni 81116)
RXN-11566 [EC: 1.5.1.43]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.43 or 1.5.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F00 at UniProt or InterPro

Protein Sequence (396 amino acids)

>DVU0418 saccharopine dehydrogenase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKVLIIGAGGVGGVVAHKCAQVADVFSEIVLASRTKSKCDAIAADIKARTGRTIETAQV
DADNVPELVALIKACKPAMVLNLALPYQDLTIMDACLETGVHYLDTANYEPLDEAKFEYK
WQWAYQERFREKGLMALLGSGFDPGVTNVFCAYAQKHLFDEIHVLDIIDCNAGDHGHPFA
TNFNPEINIREVTARGRYWERGEWVETDPLSWAMNYDFPEGIGPKKCFLMYHEELESLVQ
NLKGLKRARFWMTFSDNYLNHLKVLENVGMTRIDEVEHNGHKIVPIQFLRSLLPDPASLG
PRTKGRTCIGCLMQGVKDGKEKTAYIYNICDHEACYREVGSQAISYTTGVPAMIGAMMML
TGKWTGQGVFNMEQMDPDPFMEKLNLHGLPWVVVEK