Protein Info for DVU0408 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: response regulator/sensory box/GGDEF domain/EAL domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 715 PF00072: Response_reg" amino acids 8 to 116 (109 residues), 93.4 bits, see alignment E=3.5e-30 PF00989: PAS" amino acids 169 to 279 (111 residues), 42.6 bits, see alignment E=2e-14 PF13188: PAS_8" amino acids 169 to 220 (52 residues), 25.3 bits, see alignment 3.8e-09 TIGR00229: PAS domain S-box protein" amino acids 169 to 288 (120 residues), 45.6 bits, see alignment E=7.3e-16 PF08448: PAS_4" amino acids 175 to 284 (110 residues), 49 bits, see alignment E=2.3e-16 PF13426: PAS_9" amino acids 181 to 281 (101 residues), 26.8 bits, see alignment E=1.9e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 291 to 446 (156 residues), 124.3 bits, see alignment E=3.9e-40 PF00990: GGDEF" amino acids 293 to 444 (152 residues), 138.7 bits, see alignment E=5.4e-44 PF00563: EAL" amino acids 466 to 699 (234 residues), 257.4 bits, see alignment E=4.1e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2526)

Predicted SEED Role

"response regulator/sensory box/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F10 at UniProt or InterPro

Protein Sequence (715 amino acids)

>DVU0408 response regulator/sensory box/GGDEF domain/EAL domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDSPARILCIDDDDADRMNLVAYLEDSGYIVLEAANGRAGLDVFRAEHPDLILVDLRMP
VMGGMEVVAHMREEAPGVPVIVVSGAGILEEAVEALRRGAWDYVTKPVLDMRVLEHAVMK
ALERARLLDERQRYQERLEFEVEARTRELRVSNEQLRSTQSELEDKSLFLETLIESLPNP
LFYKTLDGVYIGCNKAFSQLLGIPREKMVGRSARDLLPDHAYAQIIAGDCPSGSDAGEHS
CVFDILGADGHIHTLALYKSTYSDSQGQVSGIVGTFLDITELKRKEAQIVHQATHDELTG
LLNRFGMRQHVDRLIVGGQMSFALLVIDLDDFKTINDSLGHALGDRLLHKAAERIVELVG
SQGIVGRPGGDEYVVLLYNVDAEAAHAMARRILDIFTDSLSVSGHEVYISLSIGIAVYPE
DGDDAANLFKCCDIAMYRAKEEGGARAQRYLAAMQDVITSRLALEKNLRKALERGEFVLH
YQPKVDIRTGAVTGMEALVRWVRDDGTIVPPQDFIPVAEKTGLIVALGEFVLREACRQMH
AWQKRFGRLKMAVNISARQFQPGLPDTVASALADAGLDPGLLELEITETTMMRDLALTVS
VLERLTTGGIAVAIDDFGTGHSSLYYLKTFPISSIKIDRSFVRDIPNDETDATIVTTVVS
MGRNLGIGIVAEGVETEAQLDFLRSLECPEVQGYYFSKPLPPHAFEAWMENRLRV