Protein Info for DVU0403 in Desulfovibrio vulgaris Hildenborough JW710

Name: dvsB
Annotation: dissimilatory sulfite reductase beta subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02066: sulfite reductase, dissimilatory-type beta subunit
  • amino acids 33 to 381 (349 residues), 496.8 bits, E=1.5e-153
• PF03460: NIR_SIR_ferr
  • amino acids 55 to 120 (66 residues), 48.8 bits, E=4.6e-17
• PF01077: NIR_SIR
  • amino acids 136 to 360 (225 residues), 131.1 bits, E=2.6e-42

Best Hits

Swiss-Prot: 100% identical to DSVB_DESVH: Sulfite reductase, dissimilatory-type subunit beta (dsvB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K11181, sulfite reductase, dissimilatory-type beta subunit [EC: 1.8.99.3] (inferred from 100% identity to dvu:DVU0403)

MetaCyc: 100% identical to dissimilatory sulfite reductase beta subunit (Desulfovibrio vulgaris)
1.8.1.g [EC: 1.8.1.g]

Predicted SEED Role

"Dissimilatory sulfite reductase, beta subunit (EC 1.8.99.3)" (EC 1.8.99.3)

MetaCyc Pathways

• dissimilatory sulfate reduction I (to hydrogen sufide)) (5/5 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (4/6 steps found)
• superpathway of tetrathionate reduction (Salmonella typhimurium) (2/4 steps found)
• sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)

KEGG Metabolic Maps

• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.3

Use Curated BLAST to search for 1.8.1.g or 1.8.99.3

Sequence Analysis Tools

See P45575 at UniProt or InterPro

Protein Sequence (381 amino acids)

>DVU0403 dissimilatory sulfite reductase beta subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAFISSGYNPEKPMANRITDIGPRKFDEFFPPVIAKNFGSWLYHEILEPGVLMHVAESGD
KVYTVRVGAARLMSITHIREMCDIADKYCGGHLRFTTRNNVEFMVADEASLKALKEDLAS
RKFDGGSLKFPIGGTGAGVSNIVHTQGWVHCHTPATDASGPVKAIMDEVFEDFQSMRLPA
PVRISLACCINMCGAVHCSDIGVVGIHRKPPMIDHEWTDQLCEIPLAVASCPTAAVRPTK
LEIGDKKVNTIAIKNERCMYCGNCYTMCPALPISDGEGDGVVIMVGGKVSNRISMPKFSK
VVVAYIPNEPPRWPSLTKTIKHIIEVYSANAYKYERLGEWAERIGWERFFSLTGLEFSHH
LIDDFRDPAYYTWRQSTQFKF