Protein Info for DVU0402 in Desulfovibrio vulgaris Hildenborough JW710

Name: dsrA
Annotation: dissimilatory sulfite reductase alpha subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02064: sulfite reductase, dissimilatory-type alpha subunit
  • amino acids 9 to 430 (422 residues), 693.1 bits, E=5.4e-213
• PF01077: NIR_SIR
  • amino acids 167 to 396 (230 residues), 128.6 bits, E=1.6e-41

Best Hits

Swiss-Prot: 100% identical to DSVA_DESVH: Sulfite reductase, dissimilatory-type subunit alpha (dsvA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K11180, sulfite reductase, dissimilatory-type alpha subunit [EC: 1.8.99.3] (inferred from 100% identity to dvl:Dvul_2532)

MetaCyc: 100% identical to dissimilatory sulfite reductase alpha subunit (Desulfovibrio vulgaris)
1.8.1.g [EC: 1.8.1.g]

Predicted SEED Role

"Dissimilatory sulfite reductase, alpha subunit (EC 1.8.99.3)" (EC 1.8.99.3)

MetaCyc Pathways

• dissimilatory sulfate reduction I (to hydrogen sufide)) (5/5 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (4/6 steps found)
• superpathway of tetrathionate reduction (Salmonella typhimurium) (2/4 steps found)
• sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)

KEGG Metabolic Maps

• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.3

Use Curated BLAST to search for 1.8.1.g or 1.8.99.3

Sequence Analysis Tools

See P45574 at UniProt or InterPro

Protein Sequence (437 amino acids)

>DVU0402 dissimilatory sulfite reductase alpha subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKHATPKLDQLESGPWPSFVSDIKQEAAYRAANPKGLDYQVPVDCPEDLLGVLELSYDE
GETHWKHGGIVGVFGYGGGVIGRYCDQPEKFPGVAHFHTVRVAQPSGKYYSADYLRQLCD
IWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFELTHNLNTDLGGSGSNLRTPESCLGK
SRCEFACYDSQAACYELTMEYQDELHRPAFPYKFKFKFDACPNGCVASIARSDFSVIGTW
KDDIKIDAEAVKAYVAGEFKPNAGAHSGRDWGKFDIEAEVVNRCPSKCMKWDGSKLSIDN
KECVRCMHCINTMPRALHIGDERGASILCGAKAPILDGAQMGSLLVPFVAAEEPFDEIKE
VVEKIWDWWMEEGKNRERLGETMKRLSFQKLLEVTEIAPVPQHVKEPRTNPYIFFKEEEV
PGGWDRDITEYRKRHLR