Protein Info for DVU0392 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: aromatic aminotransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF00155: Aminotran_1_2" amino acids 32 to 383 (352 residues), 228.2 bits, see alignment E=3.7e-71 PF00266: Aminotran_5" amino acids 90 to 203 (114 residues), 29.5 bits, see alignment E=7.6e-11 PF01041: DegT_DnrJ_EryC1" amino acids 102 to 204 (103 residues), 49.5 bits, see alignment E=7.6e-17 PF01053: Cys_Met_Meta_PP" amino acids 102 to 207 (106 residues), 28.2 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2542)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F23 at UniProt or InterPro

Protein Sequence (399 amino acids)

>DVU0392 aromatic aminotransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDVFRVSRRVQQIRISATKLMPMLAARVGGCVSLGQGVPSFRTPEHIVEAVCRALRDKA
DAGRYTLQPGMPALREAIAADLAARKGYMVNPDSEVGVTVGAMEALLMALLTVVDRGDEV
IIPSPGYASHAEQVLMAEGVPVHVPLRADDWGLDVDAIRAAVTPRTRAVIVCNPGNPTGT
VYDDADVRALCELALERNIMLISDETYDYMVYGGGEPLSPASLPEMRRHVIVVNSFSKKY
ALTGWRVGYCAADAAWMGELLKVHDAAAICAPAVSQYAALAALTGPQDCVDDMRAALSAR
RNLACARLDAMAPHFDYVQPRGAFYIMARYTFTDAPSDMVARRLLEEGRVITVPGASFGP
TGERHLRLSFGMEEAELDEAFDRMAAWTQRVVASGGLGG