Protein Info for DVU0389 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amino acid ABC tranporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 155 to 171 (17 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 109 (98 residues), 102 bits, see alignment E=1.1e-33 PF00528: BPD_transp_1" amino acids 33 to 214 (182 residues), 71.8 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 39% identical to GLNP_ECO57: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli O157:H7

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to dvu:DVU0389)

MetaCyc: 39% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F26 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DVU0389 amino acid ABC tranporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFDPDFVFGEMLPALNRGLITSMMLIVPSATLGLLFGIIVGTGRVFGPAWVRKAGDIYTA
TFRGVPLVVQLMIIYFGLPNIGIYLEPFPAAVLGFVLCSAAYNSEYVRGALLSIRQGQLK
AAQALGFSKLKTVLFIVVPQAVRRALPGCGNEIIYLIKYSSLAYVITCIELTGEGKVVAA
RSFRFTEVFLFVGAYYLFLVTLASWILHRVEQHFSIPGFGRAKQ