Protein Info for DVU0388 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amino acid ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00005: ABC_tran" amino acids 24 to 173 (150 residues), 128.4 bits, see alignment E=3.1e-41 PF13304: AAA_21" amino acids 130 to 203 (74 residues), 30.4 bits, see alignment E=3.9e-11

Best Hits

Swiss-Prot: 52% identical to GLUA_COREF: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to dvl:Dvul_2546)

MetaCyc: 49% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F27 at UniProt or InterPro

Protein Sequence (255 amino acids)

>DVU0388 amino acid ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTDNATPILRVEHLSVALGGRPILRDVSLDVDRGQLKVLIGPSGAGKSTLLQCINHLILP
DAGTVSLEGRAVDAHRKADLYAFRQQVGMIFQEFNLFDHLDALSNVSIALRKVRGMSRAA
ARERAMAELERVGLSSRHALYPAQLSGGQKQRVAIARALAMDPKVMLLDEPTSALDPELV
GEVLAVIRDLAKGGMTMVMATHQMDFARALANEIVFMERGAIIERGSPAELLAPGAGTRT
QDFCSRLTDLCEESC