Protein Info for DVU0381 in Desulfovibrio vulgaris Hildenborough JW710

Name: nhaC-1
Annotation: Na+/H+ antiporter NhaC (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 98 to 99 (2 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 136 to 164 (29 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 259 to 285 (27 residues), see Phobius details amino acids 305 to 330 (26 residues), see Phobius details amino acids 342 to 368 (27 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details TIGR00931: Na+/H+ antiporter NhaC" amino acids 6 to 458 (453 residues), 403.5 bits, see alignment E=5.6e-125 PF03553: Na_H_antiporter" amino acids 161 to 453 (293 residues), 154.7 bits, see alignment E=1.8e-49

Best Hits

KEGG orthology group: K03315, Na+:H+ antiporter, NhaC family (inferred from 100% identity to dvl:Dvul_2552)

Predicted SEED Role

"Na+/H+ antiporter NhaC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F34 at UniProt or InterPro

Protein Sequence (463 amino acids)

>DVU0381 Na+/H+ antiporter NhaC (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSDTRKPSLLWAVFTFIVPVAIILYGTVVVAVRPPVLPLLVAVVVAGAMCLRIGYSWEE
LQEGMLSAVGRIQIAVAILMLVGMIIAAWMASGTIPTIIYWGLKLIAPNHFLVSTIILCA
VASLATGTSFGTMGTIGVALLGVGTAMGYDPAWTVGAIVSGAYFGDKMSPVSDSTNIAAA
VCEVPLFTHIASMLWTTLPALVVSIIGYAILGSMHTGTAESVGNINTILTTLEGSFSLSP
VALIPPVLMIVLAYKRLPVLPVMVVCVVSALAIALFEGVSVVNLAKFLTTGYKAATPSPE
LNKLLSCGGLMSIMATTLLLTCGMAFGGILEKARVLEVLLDAILRGATSAVSLVGATVAA
AYIILFGTGSQMLAVVVPGRAFGESFRRAGIEQVVLSRTCEDAGTLGCPLVPWSVHAFYI
LGVLGVSATDYMPYAFLNYLVPVFSMACAITGIGIMRTTPKNA