Protein Info for DVU0361 in Desulfovibrio vulgaris Hildenborough JW710

Name: ilvH
Annotation: acetolactate synthase III, small subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF01842: ACT" amino acids 14 to 74 (61 residues), 39 bits, see alignment E=8e-14 PF22629: ACT_AHAS_ss" amino acids 14 to 79 (66 residues), 102 bits, see alignment E=2.3e-33 PF13710: ACT_5" amino acids 21 to 80 (60 residues), 35.6 bits, see alignment E=9.5e-13

Best Hits

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to dvu:DVU0361)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F54 at UniProt or InterPro

Protein Sequence (107 amino acids)

>DVU0361 acetolactate synthase III, small subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNGAAPAAGGLIALRLTVNNHPGVMTHICGLFARRAFNVEGILCMPVGEGTSRIWLLVNE
DERLEQMIRQVRKLQDVLEVLPFPADMSAFTRLEDSMKVWESGGCRL