Protein Info for DVU0360 in Desulfovibrio vulgaris Hildenborough JW710

Name: ilvB-1
Annotation: acetolactate synthase, large subunit, biosynthetic type (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02776: TPP_enzyme_N
  • amino acids 4 to 120 (117 residues), 140.8 bits, E=2.8e-45
• TIGR00118: acetolactate synthase, large subunit, biosynthetic type
  • amino acids 4 to 554 (551 residues), 669.8 bits, E=1.5e-205
• PF00205: TPP_enzyme_M
  • amino acids 193 to 327 (135 residues), 156.2 bits, E=6.3e-50
• PF02775: TPP_enzyme_C
  • amino acids 383 to 531 (149 residues), 167.6 bits, E=2.7e-53

Best Hits

Swiss-Prot: 61% identical to ILVB_ECOLI: Acetolactate synthase isozyme 1 large subunit (ilvB) from Escherichia coli (strain K12)

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 100% identity to dvu:DVU0360)

MetaCyc: 61% identical to acetohydroxy acid synthase I subunit IlvB (Escherichia coli K-12 substr. MG1655)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• L-valine biosynthesis (4/4 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• L-isoleucine biosynthesis II (6/8 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See Q3V893 at UniProt or InterPro

Protein Sequence (563 amino acids)

>DVU0360 acetolactate synthase, large subunit, biosynthetic type (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYRMSGAELVIRLLERQGIDCISGIPGGANLPLYDALSHSKRIRHVLARHEQGAGFIAQG
MARSTGRPAVFFATSGPGATNTLTAIADAKLDSVPVICITGQVPRSMIGSDAFQEVDIYG
MSIPVTKHNFLVRSVEDLLTVIPEAFRIATSGRPGPVLVDIPKDVQTAEVAFEAWPETGG
PDPAEAPDMEGLARAARMLAEAERPILFIGGGVVASGAGEVARVFAERTGLPTAMSLLGL
GTLPPEHPLTLGMLGMHGARCTNMLLEECDLLMVVGARFDDRATGRIEQFCPHASIIHVD
IDPSEIDKLRTAHVAITGDAGRVLEALLPMLEPVDRKAWHGHVARMKAAHPLLTPGADDP
RTPYGLVTCTAACLDDSAIIATDVGQHQMRTAQAYPLRRTRQWLTSGGLGTMGFGLPAAI
GAALANPERTVVCFTGDGSLQMNIQELATAAETGANVKIVLANNNALGLVQQQQDLFYGR
RIFASDFTHRIDFVRIAEGFGVPAVDLGRSADPKRDLARALRAKGPCLIHVPVAVEENVY
PMVPPGAANTEMIGGEAHAPAHA