Protein Info for DVU0348 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 PF27859: LIC12162" amino acids 20 to 571 (552 residues), 407.8 bits, see alignment E=5.4e-126 TIGR04331: putative transferase, LIC12162 family" amino acids 285 to 571 (287 residues), 254.7 bits, see alignment E=1e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0348)

Predicted SEED Role

"FIG00605326: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F66 at UniProt or InterPro

Protein Sequence (574 amino acids)

>DVU0348 hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPHGTAAQVTSMSDSTARRVLVLGAAPEDATPETHIMAGPWAFAGQEERFPGWETSFTIC
PPPFADPDLLAQAQDEAHTYAISRIDDIALRLGAHHGADLPRAFWEVALIPWLALCGQLL
VERQRRVQDMLRLFGDEELEVTLLPGDCAFSFHSTHDFVLHGAQDNLFNHWVFSRMIEGM
VPAAWTVRWAQPVTRHCGAPEKGLRHMARTLLYKLPFPRVKGFSTRRSLLYSLALMANRN
SADNTIPLDRLRGRMPQWCFDPDTVLLPSIPRSFYTTPLPRRVKPAARPGIRVASVASFY
DDPYRFHLAAARAAGTRLVFIQHGGNYGHVRTYGTSPVYEYNQHAFLTWGWTSHGPHKGN
FVPVPHAQLQELRGRHRDESGRLILVGAEMSTFNYRLDSKPQPFEFTHYRNDKVTFLEAL
PEATRKATLYRPYFETRSGLEDAPWVLRRVPDVERCTGSLDDHMLRCRLLVLDHHGTTLE
LAMAADVPMVLFWNMQHWRVCPETEEALGWLEEAGIYHRTPAAAAAHIARIWDDVPGWWH
SAPVREARARWSARYALTTDDDFDRVWTQTLRTL