Protein Info for DVU0346 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 395 to 420 (26 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details amino acids 465 to 486 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 13 to 273 (261 residues), 38.3 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2638)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F68 at UniProt or InterPro

Protein Sequence (512 amino acids)

>DVU0346 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAQPQQTLAKRYAYKLLANVASIPVYLTMEAILPRALGPKAYGDYSFATNMFQQFTGFLD
MGTSTCFYNALSRRQQEFGLVSFYLRATALMLVVTMLSSGLAFVPVLGDWLLPGVPAWIV
PLAALWAFLTWWGRVLRSMNDALGVTVSSEMVRTAVNLGSVAVLAGLFWAGWLNMGVLFA
QQYATLLLLAAGFGLVLRGCWQKPDFTLDREARRAYTREFWTYSSPLFVQALASTVFLVA
ERWLLQTFEGSVQQGFFALSQKVGIACFLFVSAMTPLVMRELSIAYGNKDLKEMGRLLDR
FAPLLFTVAGYFSCFTAVEAPAVVAIFGGAQYAAAIVPVQIMALYPVHQGYGQLAGAVFY
SMGRTRTMRNIAVTEYCIGFCMSWLLLAPASHFGFGLGATGLAIKTVLLQFVSVNFMLWV
GSRMIPMHFWRNVAHQAGALAFLVGAAWLCRTGTMAMGLGDATAIVRFFVSGVLYSCIVG
GGVLLFPPLAGLTRADLTGLATRALGRLRRNR