Protein Info for DVU0342 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: NAD-dependent epimerase/dehydratase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 176 (176 residues), 33.2 bits, E=1.2e-11
• PF01370: Epimerase
  • amino acids 3 to 205 (203 residues), 153.5 bits, E=2.6e-48
• PF05368: NmrA
  • amino acids 3 to 151 (149 residues), 25.7 bits, E=2.9e-09
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 242 (237 residues), 84.3 bits, E=4.8e-27
• PF01073: 3Beta_HSD
  • amino acids 6 to 118 (113 residues), 60.6 bits, E=5.2e-20
• PF13460: NAD_binding_10
  • amino acids 7 to 155 (149 residues), 59.7 bits, E=1.5e-19
• PF02719: Polysacc_synt_2
  • amino acids 39 to 237 (199 residues), 46.7 bits, E=1e-15

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to dvu:DVU0342)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase"

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• UDP-sugars interconversion (4/9 steps found)
• stachyose degradation (2/7 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See Q72F72 at UniProt or InterPro

Protein Sequence (304 amino acids)

>DVU0342 NAD-dependent epimerase/dehydratase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKITLFGGAGFLGSHVCDKLSEAGHDVTVVDLRPSPYLRPDQTMITGNILDEELVARAVE
GADMVFNYAGIADIGEANRRPVDTARINVLGNVIALEACRKAGVKRYVFASSLYVYGKSG
GFYRCSKQACELYIENYQAMHGLDYTILRYGSLYGSRADIRNAINRFVAEALEKGAITYY
GSPTALREYIHVEDAALCTVEVLKPEYANENIVLSGNQPMRVGDLFKMIGEMLGKDIEVV
YQHDPNSGHYQITPYAFMPKVGKKMTPILTTDLGQGILRVMEDVHREMHPDMHDVGGYLV
SKDE