Protein Info for DVU0341 in Desulfovibrio vulgaris Hildenborough JW710

Name: kdsB
Annotation: 3-deoxy-D-manno-octulosonate cytidylyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF02348: CTP_transf_3" amino acids 4 to 219 (216 residues), 150.4 bits, see alignment E=6.8e-48 PF12804: NTP_transf_3" amino acids 10 to 124 (115 residues), 31.4 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 35% identical to KDSB_METCA: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 100% identity to dvl:Dvul_2642)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.38

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F73 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DVU0341 3-deoxy-D-manno-octulosonate cytidylyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNIIAIIPARMGSSRFPGKPMADIHGVPMVGHVTFRTAMSKCLTETYVATCDKEIYDYAE
SVGLKAVMTGDHHVRCTTRTAEAMLKIEEATGRKADIVVMVQGDEPMVTPDMIDAAIEPM
LKDPSINVVNLMAEMETVAEFEDPNEVKVVVDFNNDALYFSREPVPSRKKGVTEVPMRKQ
VCIIPFRRDYLLKFNEMQESPLEIIESVDMMRILEHGEKVRMVPTDKRTLSVDTAEDLAR
VIEMMREDTLRAVYTK