Protein Info for DVU0330 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF00072: Response_reg" amino acids 5 to 115 (111 residues), 69.9 bits, see alignment E=3.1e-23 PF08668: HDOD" amino acids 140 to 337 (198 residues), 202.3 bits, see alignment E=8.8e-64 TIGR00277: HDIG domain" amino acids 233 to 336 (104 residues), 27.8 bits, see alignment E=8.8e-11 PF01966: HD" amino acids 235 to 368 (134 residues), 32.1 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2652)

Predicted SEED Role

"response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F84 at UniProt or InterPro

Protein Sequence (412 amino acids)

>DVU0330 response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLPVILFVDDDHNVLNGLRRMLAPQQNRWNMLFAHDAADALRIVDQTEVDVVVADIRMPG
MDGATLLRHIRTARPTTLRLVLSGYTEETSHLHTSSLAHQSISKPCDAARLVPALEDALR
LRPLIADDDLYGRLSRLDALPSLPETLREVLAELNAPNPSLRRLGTLIQRDMALSANLLR
LVNSAFYGFARRISMPEQAVVLLGVRALRSLVLAAHLFDSLGGAPVAVRQLTGLWEHGVR
TSGLAQGIATQAGLSHEERDNALSAGLLHDVGKLALAAIAPDRVNAVFERMAAGEGSFID
IERRHHKATHADVGSYLLGTWGLPIPVVTAIARHHNPADSETVLGTVTVVHVANAIDHLL
QTPDAIDALLAAGGNLTLPGCDMRHLETLGVLDALPAWLQVARDRLQAVQPA