Protein Info for DVU0327 in Desulfovibrio vulgaris Hildenborough JW710

Name: pss
Annotation: exopolysaccharide biosynthesis protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 12 to 421 (410 residues), 398.7 bits, see alignment E=4.3e-123 TIGR03013: sugar transferase, PEP-CTERM system associated" amino acids 19 to 421 (403 residues), 414.2 bits, see alignment E=7.8e-128 PF02397: Bac_transf" amino acids 233 to 415 (183 residues), 235.4 bits, see alignment E=1.7e-74

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2655)

Predicted SEED Role

"exopolysaccharide biosynthesis protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F87 at UniProt or InterPro

Protein Sequence (421 amino acids)

>DVU0327 exopolysaccharide biosynthesis protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLPAEYNVLVDYTGASTFTTFFFLLFFYVLDCYNVGHEDVRDSIARVSVASVLGIIFTGF
TFYSFEHWRFERTTFVVLLLLVVGMTLLWRMVYHRFGQRFTTRPRVVLVGVDRAGRVRKL
LNEGMPEAEILGYVGEGDVDPDAGPCLGAPYEPVEIARRYGATMLVMLPDAPVDEDIARD
LLDAKLRGLMVVDIRTLYEHVAKRIPVDQIRDEWLLTEDGFNLNTQGSVRRLKRAFDVIV
SLSLLITTAPIMLVAAIAIRMESPGPVIYRQKRVGINEQEFMVLKFRSMRTDAEKDGAVW
ATKGDSRVTRVGRFIRKVRIDELPQLWNVLRGDMSMIGPRPERMEFVRQLEKVIPYFYVR
HSVKPGITGWAQVCYPYGASVEDARYKLEYDLYYIKNMSPLLDIQIVLKTVGVILFPKGA
R