Protein Info for DVU0313 in Desulfovibrio vulgaris Hildenborough JW710

Name: fliF
Annotation: flagellar M-ring protein FliF (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 439 to 461 (23 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 2 to 481 (480 residues), 321.5 bits, see alignment E=6.4e-100 PF01514: YscJ_FliF" amino acids 46 to 219 (174 residues), 220.7 bits, see alignment E=1.4e-69 PF08345: YscJ_FliF_C" amino acids 254 to 413 (160 residues), 144.9 bits, see alignment E=2.5e-46

Best Hits

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to dvl:Dvul_2668)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FA1 at UniProt or InterPro

Protein Sequence (538 amino acids)

>DVU0313 flagellar M-ring protein FliF (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSPMITDATDKARAFWSRISMSQRVFIVGLALVTVGIFFTLILWINRPDYRVLYSNLAGE
DANRVVKLLQANKVPYKLENDGGTVLVPADKLYDLRIKVAGEGNLVGQGIGFEIFDDLKV
GQTDFVQKINYQRALQGELIRTISEFPGVETARVHLVIPHRSLFIEEQQKPSASVVVKLR
EGKKMEAQDVQAIVNLVVMAVEGMDRNRVSVADTSGKILYYPTEDDSLQGLTTTQLEYKM
RLQQNLERRIEELLYPVIGPGKVIAKVNADVDFSQRTIRRELYDPEKTVVRSEQRSEEST
RGRANLEAGAPDANFRGDGISGSASTQEGTRETRTTNFEINKEEQNIVANVGDLSRLSVA
VIVDGTYEKAADGTYTFVPRNAEEMQRIRQLVSSAVGYDRARGDTVEVNSISFGGPDLPQ
EASLPQLFLDYALRLGKPLLNALLVFLFLLLVVRPVVMALIRPKVEGEMIEGLEGLPAGE
ERLALIEGDEEVDALDALRKIEDIKAHAMQLAEQNMDQAVGIIRSWLKNDEGTKAGAA