Protein Info for DVU0310 in Desulfovibrio vulgaris Hildenborough JW710

Name: fliI
Annotation: flagellum-specific ATP synthase FliI (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR01026: ATPase, FliI/YscN family" amino acids 17 to 431 (415 residues), 574.8 bits, see alignment E=5.8e-177 PF00006: ATP-synt_ab" amino acids 146 to 355 (210 residues), 302.8 bits, see alignment E=1.3e-94 PF18269: T3SS_ATPase_C" amino acids 367 to 431 (65 residues), 67.9 bits, see alignment E=5.7e-23

Best Hits

Swiss-Prot: 57% identical to FLII_BACSU: Flagellum-specific ATP synthase (fliI) from Bacillus subtilis (strain 168)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 100% identity to dvl:Dvul_2671)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FA4 at UniProt or InterPro

Protein Sequence (437 amino acids)

>DVU0310 flagellum-specific ATP synthase FliI (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSGGPRACLDLLRECAPMQTFGKITKVVGLVAEGSGIKAPLGAVCHMLPDDGGESVAAEV
VGFRDGRLLFMPYGELRGVRPGSLIRNSSLPPVFPVGEGLLGRAFDAFGAPLDGGTPVMP
EAWAPLYASPPNPLTRPRIDTPLDVGVRCINSLLTLGRGQRVGIMAGSGVGKSTLMGMMA
RYTEAQVNVIGLIGERGREVVEFMEKDLGPEGMARSVLVVATSDQSPLVRMRAAYAATAV
AEFFRDQGKDVLLMMDSVTRFAMAAREVGLAVGEPPTTKGYTPTVFAQLPRLLERAGRSP
EGTITGIYTVLVDGDDFNEPIADAVRSILDGHIVLTRELADQGHFPAIDVLKSISRLRTD
ICPDDIVNAGRILTRHMATFRRVEDMINIGAYATGSNPDIDKAIAMVGPINDFLRQHITD
QQPLPGCYEQLLALAAS