Protein Info for DVU0285 in Desulfovibrio vulgaris Hildenborough JW710

Name: hisH
Updated annotation (from data): IGP synthase, amidotransferase subunit (EC 4.3.2.10)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01855.
Original annotation: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit" amino acids 3 to 204 (202 residues), 189.2 bits, see alignment E=3.5e-60 PF00117: GATase" amino acids 4 to 202 (199 residues), 73.1 bits, see alignment E=1.3e-24

Best Hits

Swiss-Prot: 100% identical to HIS5_DESVH: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to dvu:DVU0285)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61779 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DVU0285 IGP synthase, amidotransferase subunit (EC 4.3.2.10) (Desulfovibrio vulgaris Hildenborough JW710)
MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTG
LDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIR
VPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGAEFCAIHGGPG
LWAVQFHPEKSGRPGLRLLANFHRYCTEAADAQ