Protein Info for DVU0285 in Desulfovibrio vulgaris Hildenborough JW710

Name: hisH
Updated annotation (from data): IGP synthase, amidotransferase subunit (EC 4.3.2.10)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01855.
Original annotation: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  • amino acids 3 to 204 (202 residues), 189.2 bits, E=3.5e-60
• PF00117: GATase
  • amino acids 4 to 202 (199 residues), 72 bits, E=2.6e-24

Best Hits

Swiss-Prot: 100% identical to HIS5_DESVH: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to dvu:DVU0285)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.3.2.10

Sequence Analysis Tools

See P61779 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DVU0285 IGP synthase, amidotransferase subunit (EC 4.3.2.10) (Desulfovibrio vulgaris Hildenborough JW710)
MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTG
LDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIR
VPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGAEFCAIHGGPG
LWAVQFHPEKSGRPGLRLLANFHRYCTEAADAQ