Protein Info for DVU0282 in Desulfovibrio vulgaris Hildenborough JW710

Name: mutY
Annotation: A/G-specific adenine glycosylase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR01084: A/G-specific adenine glycosylase" amino acids 13 to 269 (257 residues), 292.8 bits, see alignment E=1.5e-91 PF00730: HhH-GPD" amino acids 41 to 167 (127 residues), 75.9 bits, see alignment E=6.1e-25 PF00633: HHH" amino acids 106 to 134 (29 residues), 29.6 bits, see alignment (E = 8.6e-11) PF00293: NUDIX" amino acids 241 to 362 (122 residues), 65.3 bits, see alignment E=1.2e-21 PF14815: NUDIX_4" amino acids 242 to 361 (120 residues), 90.1 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to dvu:DVU0282)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FD2 at UniProt or InterPro

Protein Sequence (373 amino acids)

>DVU0282 A/G-specific adenine glycosylase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHDNAPQHEYDAFAKALLDWFAAARRPLPWREHYTPYGVWISEIMLQQTQMERGVDYYLR
WMERFPDVASVATAPEADLLKAWEGLGYYRRVRNLQAAARVIMEQHDGIFPDLPDAIRAL
PGIGPYTAGAIASIAFNHDVIAVDGNVERVFSRVFDIDTPVREKTAATRIRMLTARTLPK
GRARDFNQALMELGALVCRKKPDCTACPVARFCESLHLGIPHERPVPGRRQPIVPLDVVS
GVLVHEGRIFVQRRPDTGVWAGFWEFPGGRIEPGETPEEAIIREFREETDFAVRPTDKLA
VIRHGYTTYRVVLHCYLLHIDASSRSAPPEHPVITAATDHRWATLADIDALTLPAGHRKL
ADLLAADLRFAGL