Protein Info for DVU0278 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glyoxalase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00903: Glyoxalase" amino acids 7 to 122 (116 residues), 50.1 bits, see alignment E=3.7e-17 PF18029: Glyoxalase_6" amino acids 8 to 122 (115 residues), 33.6 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: K07032, (no description) (inferred from 98% identity to dvl:Dvul_2702)

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FD6 at UniProt or InterPro

Protein Sequence (140 amino acids)

>DVU0278 glyoxalase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRTLSLVTLGVTDLARSRDFYARTGWKVASCSNEHIVFLHGGGATLALFPRDALLEDCG
LTGNAPTPGGVTLACNVASRDEVDARLAQVVEAGGRLIAPARDKPWGYGGYFADPDGHPW
EVAHVPSLTLDVEGRIILDA