Protein Info for DVU0270 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details PF00672: HAMP" amino acids 221 to 267 (47 residues), 27 bits, see alignment 1.7e-09 PF08448: PAS_4" amino acids 286 to 392 (107 residues), 44 bits, see alignment E=8.2e-15 amino acids 408 to 510 (103 residues), 35.6 bits, see alignment E=3.3e-12 PF13426: PAS_9" amino acids 291 to 389 (99 residues), 19.5 bits, see alignment E=3.5e-07 amino acids 414 to 509 (96 residues), 31.8 bits, see alignment E=5.2e-11 TIGR00229: PAS domain S-box protein" amino acids 398 to 516 (119 residues), 58.2 bits, see alignment E=4.6e-20 PF13188: PAS_8" amino acids 403 to 457 (55 residues), 28.2 bits, see alignment 4.5e-10 PF00989: PAS" amino acids 403 to 503 (101 residues), 45.4 bits, see alignment E=2.6e-15 PF00512: HisKA" amino acids 526 to 593 (68 residues), 36.7 bits, see alignment E=1.3e-12 PF02518: HATPase_c" amino acids 640 to 751 (112 residues), 85.9 bits, see alignment E=9.1e-28

Best Hits

KEGG orthology group: K10819, histidine kinase (inferred from 100% identity to dvl:Dvul_2710)

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FE4 at UniProt or InterPro

Protein Sequence (756 amino acids)

>DVU0270 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDSARVPWRRTLAFRVVGAAAVPLFVAVVILSWGSITYQKSHLFDELSNGADRLSNTIRL
GARYAMMINARDEINQIIRDVSGQKAIASIRIYNKEGVIKFSGDASEVEERTNIRDEACR
RCHETEPPRPSLSLQERVRVFTGPEGQRYLGSLSPIYNEPGCSGPPCHFHPEEKLVLGAL
DVVLPLEGAESEILSFQRRVILLAAAVFLLGGGGIALLLDRFLTRPVGVLIEGTRRVARG
EAVNLNAVRQGDEIGELARAISRMSRDIVDKQEELNRQRDEYQQLFDQVPCTITVQDTSL
RLLKYNREFRERFNPTPGEHCFKAYKGRTDKCPHCAVARTMETGLPHCSEESGYNADGTR
AHWLVHTTPVFNAEGAVVAAMEMCLDITARKELEERLRRSELKYHAIFNNIPSAVFVLEE
ASLDIIDCNSTAEAVYGWKAEEVRGRNFLHLFAPDERERYASQLRAFTVLNRARHFKRDG
TPFFVDIMLSPSEYNGRQVLLLTTSDITQRLEAEQKVIQAGKMATLGEMATGVAHELNQP
LTVIKAASGFLLRKARKGEPVAPDVLSTMTAEMDAHVDRASRIIEHMREFGRKSDIVLER
VSVNEVLRSATEFFSRQMTVRGITIEWQLDASEPVVMAVANRLEQVVINLLLNARDAIEE
HAAAHDARRVITLRTETDGREVVMEVCDSGPGIPRALQQRIFEPFFTTKKVGKGTGLGLS
ISYGLVKDFGGSISVGDAPGGGARFTVRMPDAGRNA