Protein Info for DVU0264 in Desulfovibrio vulgaris Hildenborough JW710

Name: tmcB
Annotation: Transmembrane complex, ferredoxin, 2 [4Fe-4S] (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF13183: Fer4_8" amino acids 46 to 120 (75 residues), 39.5 bits, see alignment E=1.3e-13 PF13534: Fer4_17" amino acids 48 to 121 (74 residues), 29.2 bits, see alignment E=2.2e-10 PF02754: CCG" amino acids 320 to 409 (90 residues), 33.4 bits, see alignment E=7.9e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0264)

MetaCyc: 100% identical to Tmc electron transfer complex B subunit (Desulfovibrio vulgaris)

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP protein DsrK (=HmeD)" in subsystem Sulfate reduction-associated complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FF0 at UniProt or InterPro

Protein Sequence (439 amino acids)

>DVU0264 Transmembrane complex, ferredoxin, 2 [4Fe-4S] (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MGITERRIEDAGLMRGIAALTPERIEKVVKAVTEGEAGARLKVYYETCMRCGLCAKACHY
CISHDGEPDYSPVGKMEQTMWRLLREGGRVSPDVIYDMAQIAYTECNLCRRCIHYCPIGI
DTGYVISLVRRICHRLGVTPRYMQDTAHSHAATFNQMWVKEDEWVDSLIWQEDEARSEIP
TMRIPLEVEGADILYSVIAPEPKFRTQLIYQAAVIMDQAGVSWTMPATPGWDNSDMAMFS
GDSEVMGRIKRAHFELAQRLRVKRIVMGECGHAFRSIYDVGNRWLGWKMHPVPVVHSVEF
FWELFDQGKIKLAKRFEEPVTIHDPCNIVRGRGLMDKLREVVHALCPNVVEMTPNREHNF
CCCAGGGVINCGPPFKGVRVEGNRIKAEQLKATGVKTVIAPCHNCHGGLEDIIHHYKLGM
HTKFLGDIIYDCMEKPGAV