Protein Info for DVU0263 in Desulfovibrio vulgaris Hildenborough JW710

Name: tmcA
Annotation: Transmembrane complex, tetraheme cytochrome c3 (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02085: Cytochrom_CIII" amino acids 33 to 123 (91 residues), 48.9 bits, see alignment E=3.5e-17

Best Hits

Swiss-Prot: 42% identical to CYC3A_DESAF: Acidic cytochrome c3 from Desulfovibrio africanus

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0263)

MetaCyc: 100% identical to type II cytochrome c3 (Desulfovibrio vulgaris)

Predicted SEED Role

"Tetraheme cytochrome c isozyme 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FF1 at UniProt or InterPro

Protein Sequence (126 amino acids)

>DVU0263 Transmembrane complex, tetraheme cytochrome c3 (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MFRRIGTVMLAFATLALLLAVAFARTDTPRLEPEALKPQQRPAAVFDHDAHNEKAKLENC
AVCHHDAKDGKIVPEGSSEGTPCADCHAKAATKGTHLVNAYHRQCMNCHKTSGKGPTSCG
GCHVRD