Protein Info for DVU0258 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 PF00072: Response_reg" amino acids 5 to 110 (106 residues), 109 bits, see alignment E=3.6e-35 PF08448: PAS_4" amino acids 184 to 284 (101 residues), 28.7 bits, see alignment E=3.3e-10 amino acids 300 to 406 (107 residues), 48 bits, see alignment E=3.4e-16 PF13426: PAS_9" amino acids 209 to 280 (72 residues), 21.4 bits, see alignment E=6.2e-08 amino acids 306 to 403 (98 residues), 23.7 bits, see alignment E=1.2e-08 TIGR00229: PAS domain S-box protein" amino acids 293 to 411 (119 residues), 33.9 bits, see alignment E=1.5e-12 PF02518: HATPase_c" amino acids 524 to 634 (111 residues), 86.4 bits, see alignment E=4.7e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0258)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FF6 at UniProt or InterPro

Protein Sequence (657 amino acids)

>DVU0258 sensory box histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSESILLVDDEEGIRKVLGITLADAGYRVTTAADGEEAMRRFAEERPDIVLTDIKMPGMS
GLELLESIKSRDSEVEVIMLTGHGDMELAIQSLKRDATDFITKPINDDVLDIALGRARER
ITMRRRLREYTENLEDMVAKQSARLVAAERQLAALQVMDGIASGVQTLSRMLDQAGIFNE
LPCFVSMHSRYLEIVATNDLYKERLGHKVGQPSWEVYKGREGSGNGCPVWKVIETGEGQR
SNEILIDKHGQEIPVIVHTAPILDNDGEIEMVLEISVDVSKVRRLQDELRITRERYRQLF
DEAPCYIAVIDRSLKVVDANRRFHHDFGEPAARHCHDIFAHRLAACQGCPVERSFDDGKP
HQYETVVTTGDGRQANVLVWTSPLRDAAGNITEVMEMSTDITQVRQLQDRLSQLGLLLGS
TAHGIKGLLTALDGGVYRLGSGLDRNDEARVRDSFEDIRHLTGRLRKMVLDILYYAKKRD
LNWEVVVAERFATETAELIEGKAVNRGVGFQLEIAAESGTFEADAGALSAALVNLLENAV
EACAAERSRPEHSVTFSVGGDANHVEFSVRDDGVGMDRETREKLFTLFFSSKGSAGTGIG
LFVANQVVQQHGGHIAVASEPGHGTTFTVSLPRRLPDVARCPAPQNGQPEGDEADDN