Protein Info for DVU0242 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: SEC-C motif domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF02810: SEC-C" amino acids 3 to 18 (16 residues), 22.1 bits, see alignment (E = 1.1e-08) amino acids 144 to 162 (19 residues), 39.3 bits, see alignment (E = 4.7e-14) PF17775: YchJ_M-like" amino acids 28 to 127 (100 residues), 104.7 bits, see alignment E=3.9e-34

Best Hits

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 100% identity to dvu:DVU0242)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FH1 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DVU0242 SEC-C motif domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNACPCGSGLALEACCGPYLHEGKTVPTPEALMRSRYTAHTLGMYDYLDETTHPDTREDV
STEEMRAWSEAVQWEGLEVLETRGGHEGDVTGEVSFVARYMLGGVPQELREDSFFRREGD
RWYYVDGMVHGSEPYRREQPKVGRNEPCPCGSGRKYKKCCGK