Protein Info for DVU0202 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: holin (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 27 to 57 (31 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details PF05105: Phage_holin_4_1" amino acids 32 to 147 (116 residues), 94.2 bits, see alignment E=2.9e-31 TIGR01593: toxin secretion/phage lysis holin" amino acids 38 to 144 (107 residues), 45.8 bits, see alignment E=2.8e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvu:DVU2867)

Predicted SEED Role

"Holin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FL1 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DVU0202 holin (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLDQLALWCGIQCRELTENSVFKSALAAVFAWVAGMLGGVANVLPFLAILLVLDYVLGFV
RACRIRRISGAKMRAGAWKFLFYFAAVFVVATVDGALGKAWTLFHVPMGAFFVFYLCVNE
AMSCLDHLKFFGVPIPEWLSTRLRDYRETFCPPAGRAASGTK