Protein Info for DVU0180 in Desulfovibrio vulgaris Hildenborough JW710

Name: modC
Annotation: ATP-binding component of molybdate ABC transporter (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00005: ABC_tran" amino acids 27 to 170 (144 residues), 110.9 bits, see alignment E=7.6e-36 PF13304: AAA_21" amino acids 122 to 203 (82 residues), 27.4 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to dvu:DVU0180)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FN3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>DVU0180 ATP-binding component of molybdate ABC transporter (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MIEVRISRKLAGCGRPFTLRADFTSNARRVVLFGHSGSGKTLTLHCVAGLARPDEGVITI
DGRTLFNAQADGSPRVDIPPRRRNVGYMFQDYALFPHLTVRRNVGFGMERGPWRLGREGR
QRVDELLNFFEIGHVADRYPADISGGQRQRVALARALATSPSVLLLDEPFSALDPLLRRR
MRDEFGSLLERCGVPALIITHDPDDVDAFAQTLVVYAEGRTLPPLDFATARSGMPSTVEM
LEGLLLEGAVIPR