Protein Info for DVU0176 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycerophosphoryl diester phosphodiesterase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01126, glycerophosphoryl diester phosphodiesterase [EC: 3.1.4.46] (inferred from 99% identity to dvl:Dvul_2792)

Predicted SEED Role

"Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 3.1.4.46)

MetaCyc Pathways

glycerophosphodiester degradation (2/2 steps found)
glycerol and glycerophosphodiester degradation (3/4 steps found)
phosphatidylcholine resynthesis via glycerophosphocholine (1/2 steps found)
phospholipid remodeling (phosphatidylethanolamine, yeast) (1/4 steps found)
anandamide biosynthesis I (3/12 steps found)

KEGG Metabolic Maps

Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FN7 at UniProt or InterPro

Protein Sequence (299 amino acids)

>DVU0176 glycerophosphoryl diester phosphodiesterase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPNPFFSSSGQRPLVIAHRGARAHAPENTLAAARLAHNHGADLWELDVCRTRDGVLVVM
HDDTCARTTDARLHPALAGRAPWPVHELTLDELRGLDAGSWFVEGDPFGRIALGEVGPGM
CRAYKGEPVPTLAEALALTRSLRWRVNVEIKDLAGTPGDATVVDEVLSLVDDHAMAASVL
LSSFRHDYMREAHRKRPHIPTALLIESIGDNAPLALCHEAGAVALHPRSTLMDDHALGAC
IAAGLHVNVWTVNSLREVARLTRMGVSGIITDIPGECLAALRAQRLRTDTPLRPFPPAP