Protein Info for DVU0165 in Desulfovibrio vulgaris Hildenborough JW710

Name: oppF
Annotation: oligopeptide/dipeptide ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00005: ABC_tran" amino acids 43 to 195 (153 residues), 119.4 bits, see alignment E=1.8e-38 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 246 to 330 (85 residues), 97.8 bits, see alignment E=1.6e-32 PF08352: oligo_HPY" amino acids 248 to 311 (64 residues), 69.3 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 50% identical to DPPF_HAEIN: Dipeptide transport ATP-binding protein DppF (dppF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to dvu:DVU0165)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FP8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>DVU0165 oligopeptide/dipeptide ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQQKPLLNLRNVVKHFDISGGFLDQLRLTGSGIVRKRTVVHAVNDVSFTINEGETLSVVG
ESGCGKSTLARTVIGLYRPNSGEIHYRDRRIDHLSDTEMLPYRTRMQMVFQDPYASLNPR
MRVNQILEEPIRFHNPGIGEGEVLDRVAAVMEQVGINPVWATRYPHEFSGGQRQRISIAR
ALAVDPEFIVADEPISALDVSIQAQVLNLMMDMQEQRNLTYLFISHDLSVVEHISTRVAV
MYLGSLCELATSEDLFGSPRHPYTQALLSAIPRIGQKGLKHIRLSGDVPTPINLPSGCVF
HGRCPHADKRCMNEVPRALPQPGGALVACHAVEEGRI