Protein Info for DVU0159 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: thioesterase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 26 to 97 (72 residues), 64.7 bits, E=3.9e-22

Best Hits

Swiss-Prot: 44% identical to Y535_CHLTR: Uncharacterized acyl-CoA thioester hydrolase CT_535 (CT_535) from Chlamydia trachomatis (strain D/UW-3/Cx)

KEGG orthology group: K01076, [EC: 3.1.2.-] (inferred from 100% identity to dvu:DVU0159)

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See Q72FQ4 at UniProt or InterPro

Protein Sequence (173 amino acids)

>DVU0159 thioesterase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQAKKVSESEVVMTHRPLPQDANPAGYVHGGVILKHIDLAGAVAAMRHCRTPVVTASIDR
MDFRAPVNVGELMLLKASVNLTGGTSLEVGVRVEAENLLTGEVRHAASAYLTFVAMGPDR
KPVAVPPLLCETPTHERRCVEARRRRELRREERRAERDAQAAQHCTCDDEPVV