Protein Info for DVU0156 in Desulfovibrio vulgaris Hildenborough JW710

Name: pcrA
Annotation: ATP-dependent DNA helicase, UvrD/REP family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 transmembrane" amino acids 75 to 93 (19 residues), see Phobius details PF00580: UvrD-helicase" amino acids 8 to 275 (268 residues), 232.3 bits, see alignment E=2.8e-72 PF13245: AAA_19" amino acids 12 to 261 (250 residues), 75.1 bits, see alignment E=1.8e-24 PF13361: UvrD_C" amino acids 281 to 428 (148 residues), 67 bits, see alignment E=6.5e-22 amino acids 507 to 590 (84 residues), 75.3 bits, see alignment E=2e-24 PF13538: UvrD_C_2" amino acids 532 to 590 (59 residues), 37.4 bits, see alignment 5.7e-13

Best Hits

KEGG orthology group: K03657, DNA helicase II / ATP-dependent DNA helicase PcrA [EC: 3.6.4.12] (inferred from 100% identity to dvu:DVU0156)

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA, proteobacterial paralog" in subsystem DNA repair, bacterial UvrD and related helicases

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FQ7 at UniProt or InterPro

Protein Sequence (719 amino acids)

>DVU0156 ATP-dependent DNA helicase, UvrD/REP family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIEFAKELNAAQYEAVTTLDGPVLVIAGAGSGKTRTVVYRLANLLERGVPASSILLLTFT
RKAANEMLQRASRLLGYGVQGIAGGTFHAFAYSLLRQYHPARLEGRDLTIMDGADSVAAI
QHCKDALGIARGDKSFPKTQTVLSLLSKSRNKELPLDEVLRREAYHLLVHADGVSRIGEA
YAEYRAEHGLLDYDDLLFEVERLLRERPDLLAHLRDRYRYIMVDEYQDTNLVQARLVQLL
AGEGGNVMAVGDDAQSIYAFRGANVQNILSFPQFFPGTRIIKLEENYRSTQPVLDLTNAI
LAEAPQAYRKHLYTSREDGVLPQVVRPLSDLTQASIVVSRVSELLRTYPPHEIAVLFRAG
FHSYHVEVQLNKLGIRFRKYGGVRYSEAAHVKDVMAYARLVLNPLDLPAFQRVAALSRGV
GPKTTLRLYEVARQGDPAATAHACARYPQLRADLELLDRLRKRTPAPATLLEEVIEHYQP
RLEAAYPDDWPRRQQGLEQLVQIASAYRDLDLFISDLSLEDPGTEEEDRDSVVLSTIHSA
KGLEWSAVIILDLVEDRFPSRHAVTRADDFEEERRLMYVACTRARERLMLFVPSSLYQRG
EGGNQPAAPSPFVRELPAALYEEWYESYTGGLQRRDTSRPVARPAVASTFGCAPRPESAP
VPGGPSPVAGAAKLGFCTHKIFGRGKIVQHLPPDKYRVNFPGVGLKVILGDYLTLEDDA