Protein Info for DVU0144 in Desulfovibrio vulgaris Hildenborough JW710

Name: rfaE
Annotation: cytidyltransferase-related domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR02199: bifunctional protein RfaE, domain II" amino acids 56 to 196 (141 residues), 188.1 bits, see alignment E=7.4e-60 TIGR00125: cytidyltransferase-like domain" amino acids 65 to 130 (66 residues), 46.7 bits, see alignment E=2.9e-16 PF01467: CTP_transf_like" amino acids 67 to 162 (96 residues), 61.8 bits, see alignment E=4e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2823)

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FR9 at UniProt or InterPro

Protein Sequence (200 amino acids)

>DVU0144 cytidyltransferase-related domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MADTTVPQGATGDAPGKHAEGAHSEGVSAPSLDACAGALPAHPGVVTLSRLVDCLAPLRA
AGKRIVFTNGCYDIVHPGHVDLLARARAEGDLLVLGLNSDESVRRQGKGADRPVNPFEVR
AFVLAHLASVDFVVRFDEDTPYELIKAVRPHVLVKGGDWAIDRIVGRDIVEGDGGRVLSL
PLLPGFSTTALISRIRTTHP