Protein Info for DVU0141 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: peptidase, M50 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 60 to 79 (20 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details PF02163: Peptidase_M50" amino acids 140 to 185 (46 residues), 34.2 bits, see alignment 8.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0141)

Predicted SEED Role

"FIG004556: membrane metalloprotease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FS2 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DVU0141 peptidase, M50 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFDLDMSMQVRRLAVAFVPMLLGIVCHEVAHGWAAWRQGDPTARSLGRLTLNPAPHIDPM
GGLMFVLTSLMGPFIIGWAKPVPVNPRWFANPRRGMMLVSLAGPGANVVLAVAFGLVLKL
FVMLLPPMQWQGDGTYDFFMNMLITGVWVNFTLAWFNMLPLPPLDGGHVVAGLLPSRLAW
RYEQLERYGFVIIILLLASGIVGRVIYPLIQGSVYMVLWSLGLA