Protein Info for DVU0139 in Desulfovibrio vulgaris Hildenborough JW710

Name: cckA
Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details PF02743: dCache_1" amino acids 49 to 217 (169 residues), 48.5 bits, see alignment E=1.2e-16 PF00512: HisKA" amino acids 336 to 405 (70 residues), 33.8 bits, see alignment E=4.2e-12 PF02518: HATPase_c" amino acids 452 to 558 (107 residues), 83.8 bits, see alignment E=1.9e-27

Best Hits

KEGG orthology group: K02482, two-component system, NtrC family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to dvl:Dvul_2828)

Predicted SEED Role

"sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FS4 at UniProt or InterPro

Protein Sequence (570 amino acids)

>DVU0139 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHAETAGAPRHRRTAVNRTIYAAILVASVMPIAIILGVMQVHLESTYSAIVRRGLREIAD
RHSQKVDDFLHERLASVQTLAMSQGALLLDPAQLASHLETLQRVHKGVYVDMGLVDAKGI
QQVYAGPLDLRMADYSGKEWFREAVLRDSFISDVFMGIRQAPHFIVTTKVVLNGQPWILR
STIDFASFVSLVEDIRVGATGVACIINRQGEFQTAGNRHPLPEGTALAAQARRLFGPGFT
ARPTERVFEDGGNLYAMSLLKHGDWVLVVQEQREEALAALADAKQTLFAVLVLVSIGVIV
GGVLLAWRIMDRLDEMEREMAALNAQVVEAGKLGALGEMAAGIAHEINNPVAIMMEEAGW
IEDILADLGEGNPAAPEIARSAAQIRSQGKRCRDITHKLLSFARKSDRDLQRLDLNHLIR
ELVGLCDQRAASAGVTVSLALVDQLPAVLASPSEMQQVFLNLFNNAFDAMEGSGGALRVT
SGVAAGNMVFVTVADTGPGIPEAILQRIYDPFFTTKPVGKGTGLGLSICYGIVKKLGGEL
RVNSLTGVGTSFQVLLPRAGEGVQAVERHD