Protein Info for DVU0129 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box/HDIG domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR00229: PAS domain S-box protein" amino acids 5 to 118 (114 residues), 32.5 bits, see alignment E=8e-12 amino acids 125 to 244 (120 residues), 91.5 bits, see alignment E=4.7e-30 PF13188: PAS_8" amino acids 6 to 62 (57 residues), 37.8 bits, see alignment 5.6e-13 amino acids 125 to 172 (48 residues), 25.4 bits, see alignment 4.4e-09 PF00989: PAS" amino acids 6 to 95 (90 residues), 30.9 bits, see alignment E=1.1e-10 amino acids 128 to 235 (108 residues), 55.7 bits, see alignment E=2.1e-18 PF08448: PAS_4" amino acids 11 to 118 (108 residues), 29 bits, see alignment E=4.7e-10 amino acids 133 to 238 (106 residues), 55.1 bits, see alignment E=3.7e-18 PF13426: PAS_9" amino acids 136 to 237 (102 residues), 57.5 bits, see alignment E=6.5e-19 PF08447: PAS_3" amino acids 147 to 229 (83 residues), 30.8 bits, see alignment E=1.3e-10 PF13487: HD_5" amino acids 273 to 427 (155 residues), 118.3 bits, see alignment E=1.5e-37 TIGR00277: HDIG domain" amino acids 275 to 364 (90 residues), 33.1 bits, see alignment E=4e-12 PF01966: HD" amino acids 277 to 396 (120 residues), 64.1 bits, see alignment E=6.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2835)

Predicted SEED Role

"Response regulator/sensory box/HDIG domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FT4 at UniProt or InterPro

Protein Sequence (452 amino acids)

>DVU0129 sensory box/HDIG domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGLDTRYRAIFKSLPQPAFVIDGRRRILDCNGAAVRMLGVAPSCHIGDRLETCLPGLEPD
ELAPCGPTEFERRWNMHGEERHFRVRVAPVLEQERRPPAVDSGNGAVVVITDITERRRQL
SERLRLGAMVEFIDDAIVAFDGEGRITAWNPGAERTYGYRRDEVVGQDVMLLMPRDRKYE
AVGLHDRVLRGGETVRVETLRRRAGGEVFPVSLTLSPVQDDAGRIVGVSALARDITDRWR
LQEARARHLGDLRGALAGTVRALSRAAGLRDSYTALHQQRVARLAVAVGQELGMGAASLE
TLETASLLHDIGKVSIPAEVLVKPVKLTTLEMALVRSHVEQGWEVLHDVPFSGPVAEVVY
QHHERLDGTGYPRGLRGDAILQEARIVTVCDVVEAMSSHRPYRPALGVEVALAEVERHAG
TRYAPEVVAALRRVLDTPDGGLRRELAETFSD