Protein Info for DVU0119 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 179 to 198 (20 residues), see Phobius details PF17203: sCache_3_2" amino acids 88 to 176 (89 residues), 37.7 bits, see alignment E=5.2e-13 PF00672: HAMP" amino acids 198 to 251 (54 residues), 30.2 bits, see alignment 1.1e-10 PF00512: HisKA" amino acids 273 to 333 (61 residues), 36.5 bits, see alignment E=9.9e-13 PF02518: HATPase_c" amino acids 380 to 471 (92 residues), 82.6 bits, see alignment E=6.9e-27 PF10090: HPTransfase" amino acids 382 to 425 (44 residues), 25.7 bits, see alignment 2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0119)

Predicted SEED Role

"integral membrane sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FU4 at UniProt or InterPro

Protein Sequence (554 amino acids)

>DVU0119 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRFGMQAKFILFAVPCIAIFAGVLSFVTIQREEDLLLRNATQQGMGIARISAVLFTNARI
YEDLGMVDTSGMSDYLDYFVADVMRLDTRIVYFMVFDPEGRVIAHNNLREYGRRHTDETT
RTALAATFPTVSRQDTANLGPHLDIAVPLSIGSKRWGVCRIGFSLREMYRSLDALRREVL
GISAVLLLVALAGVWYAGRHFARPLAALTRTMNDITARGDLAGPLPDLPRRDDEIGTLQA
SFMWMTRRLRDAERERLRAVEGMYQTEKLATIGQLASGVAHEINNPLGGVILCFRNLTEG
GMDEATRRQHIEVIDDGLEKIRRIVRELMHYARPAPLSVREARADDLIDRTLALVDYTLQ
RRRINVVRHVSPDVPPLAIDPDKMGQVLLNLVLNGADAMPDGGTLTITARRAGDDVRIEV
QDTGSGVAEEHRERIFDPFFTTKPAGSGTGLGLAVSASIVMRHGGTLTLEPPHDEAGPSD
SALFIQTPPAQSPPAPEAPSAEASPEGCPEAHKGACTDTPPDTTPHAHGGQHAGQDHPAG
ATFVISLPLARETP