Protein Info for DVU0114 in Desulfovibrio vulgaris Hildenborough JW710

Name: hisG
Updated annotation (from data): ATP phosphoribosyltransferase (EC 2.4.2.17)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00070.
Original annotation: ATP phosphoribosyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR00070: ATP phosphoribosyltransferase" amino acids 7 to 192 (186 residues), 172.8 bits, see alignment E=6.9e-55 PF01634: HisG" amino acids 53 to 213 (161 residues), 154.4 bits, see alignment E=2.5e-49 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 193 to 293 (101 residues), 92.6 bits, see alignment E=1.4e-30 PF08029: HisG_C" amino acids 219 to 291 (73 residues), 78.6 bits, see alignment E=3.1e-26

Best Hits

Swiss-Prot: 100% identical to HIS1_DESVH: ATP phosphoribosyltransferase (hisG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to dvl:Dvul_2849)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62364 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DVU0114 ATP phosphoribosyltransferase (EC 2.4.2.17) (Desulfovibrio vulgaris Hildenborough JW710)
MSIRTPMKLGIPKGSLEEATINLLARSGWKIRKHHRNYFPEINDPELTARLCRVQEIPRY
IEDGILDVGLTGKDWLLETGSDVVVVSDLVYSKVSNRPARWVLAVAGDSPYTRPEDLAGK
RIATELLGVTKRYFADAGIEVNVQYSWGATEAKVVEGLADAIVEVTETGTTIKAHGLRII
SEVLLTNTVLIANRAAWEDPCRRRKIEQIDLLLQGALRADSLVGLKMNVPTRCLDAVLDQ
LPSLNSPTVAGLRDNTWFAVEIVVDNGVVRDLIPRLREAGAEGIIEYALNKVI