Protein Info for DVU0113 in Desulfovibrio vulgaris Hildenborough JW710

Name: hisI
Annotation: phosphoribosyl-AMP cyclohydrolase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF01502: PRA-CH" amino acids 29 to 103 (75 residues), 119.5 bits, see alignment E=2.2e-39

Best Hits

Swiss-Prot: 100% identical to HIS3_DESVH: Phosphoribosyl-AMP cyclohydrolase (hisI) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 100% identity to dvu:DVU0113)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62386 at UniProt or InterPro

Protein Sequence (126 amino acids)

>DVU0113 phosphoribosyl-AMP cyclohydrolase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTAFVPDFGKAGGLVPAIAQDADTGEVLMMAWMNAEAFEMTLKTGEAHYFSRSRGRLWHK
GGTSGHTQHIRAVRLDCDSDTILLLVEQRGGAACHEGYRSCFYREMKDGEVSICSPKVFD
PKEVYK