Protein Info for DVU0106 in Desulfovibrio vulgaris Hildenborough JW710

Name: glnP
Annotation: glutamine ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 95 to 110 (16 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 112 (98 residues), 92.3 bits, see alignment E=1.1e-30 PF00528: BPD_transp_1" amino acids 35 to 217 (183 residues), 80.7 bits, see alignment E=5.7e-27

Best Hits

Swiss-Prot: 35% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: K10037, glutamine transport system permease protein (inferred from 100% identity to dvl:Dvul_2856)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FV7 at UniProt or InterPro

Protein Sequence (223 amino acids)

>DVU0106 glutamine ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAFDFQPQVMLDTAPLLLAGVKLTVLITLGGLALGFLLGAVAGLANSGRKAAFKVPATIY
IEAIRGTPLIVQVMFLYFGVPLATGMRIPPETAGILAIAVNSGAYIAEIVRGAIASIDTG
QSEAGRSIGLTRLQTMLYIIWPQAFRRMIPPLGNQFIISLKDTSLLVVIGVGELTRQGQE
IIAVNFRAFEVWLTVAVFYLAMTLSIAWALRRLERSFSARSAR