Protein Info for DVU0104 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cation ABC transporter, permease protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details PF00950: ABC-3" amino acids 8 to 263 (256 residues), 168.3 bits, see alignment E=1.2e-53

Best Hits

KEGG orthology group: K09819, manganese/iron transport system permease protein (inferred from 100% identity to dvl:Dvul_2858)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FV9 at UniProt or InterPro

Protein Sequence (278 amino acids)

>DVU0104 cation ABC transporter, permease protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGSSPFDHAFMLHALAAGALAGVACSVAGVFAVLMRLTFIGVCLAHAAFAGGLLALAFGL
PSLPAALASSMVAALVVGPLADRGEISPDTAVGIVFSAMIGVAVLCMGLLPGPKTEALNL
FWGSILTVRPRDVWLLAAVAGVAVVGVAVFFKEVQAVACHRSVAAAVGIPATAVFYAILL
QTGVTVTACLPSVGGLLVYSLLVSPAAAAYQLTYSLGRMFLLAMFFGALSGVGGVLVAWY
LDVPAGAAVVLFSCALFLLAAWFSPKRDRAARSASSRG