Protein Info for DVU0103 in Desulfovibrio vulgaris Hildenborough JW710

Name: fepC
Annotation: cation ABC transporter, ATP-binding protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00005: ABC_tran" amino acids 51 to 213 (163 residues), 83.2 bits, see alignment E=2.9e-27

Best Hits

KEGG orthology group: K09820, manganese/iron transport system ATP-binding protein (inferred from 100% identity to dvu:DVU0103)

Predicted SEED Role

"Ferrichrome transport ATP-binding protein FhuC (TC 3.A.1.14.3)" in subsystem Iron acquisition in Vibrio (TC 3.A.1.14.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FW0 at UniProt or InterPro

Protein Sequence (313 amino acids)

>DVU0103 cation ABC transporter, ATP-binding protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MCTAYSSDCPPASSALHGGPAAPPAAVAAPVVSLREVSVVRRGRCILAVESFEAQSGEFV
VVVGPNGAGKSTLLGVMNGFVRPAFFRPAFFRPGSGGPGNGRAEVLGCDMRSFGGWRVRK
RVALVAQMVDVDARLPISVLETVMVGGYGRLGLWRRPGKALRELALSHLERTGIAHLAHR
PFGQCSGGERQRAAIARALTQEPDILLLDEPTSALDWHAQRGILALVADIHAERRHTARP
LTTVMVTHDLNALYHGGEGEARRTVPDRVVCMAEGRVTWSGPVADALDAERLTALYGTPI
DIIRHGPRPVVLF