Protein Info for DVU0097 in Desulfovibrio vulgaris Hildenborough JW710

Name: potB
Annotation: polyamine ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 33 to 33 (1 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 194 to 225 (32 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 272 (190 residues), 42.3 bits, see alignment E=3.6e-15

Best Hits

Swiss-Prot: 50% identical to POTB_SALTI: Spermidine/putrescine transport system permease protein PotB (potB) from Salmonella typhi

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 100% identity to dvl:Dvul_2865)

MetaCyc: 51% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FW6 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DVU0097 polyamine ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKRNAFRNASIAVVALWLGLFALLPNAGLLLVTVLQRGEQDFVEPVFTLANYARLFDPT
FLRILWDSIALAATSTFVCLLVGYPFAYRIAMARRSVRPWFLLLVIIPFWTNSLIRTYAL
IILLKSQGLVSDVLLFLGFIDAPISLMYSDLAVFVGLTYTLLPFMILPLYVSIDKLDRKL
LDAAKDLGAGSLRAFWHVTLPLTMPGIVAGSMLVFLPSLACFYIPEILGGAKAMLIGNFI
KNQFLVARDWPLGAAASTILTLLLVLLIVAWWLASRRVAAREKHEQDAALFTEAG