Protein Info for DVU0095 in Desulfovibrio vulgaris Hildenborough JW710

Name: potD-1
Annotation: polyamine ABC transporter, periplasmic polyamine-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02030: Lipoprotein_8" amino acids 16 to 101 (86 residues), 24.7 bits, see alignment E=2.5e-09 PF01547: SBP_bac_1" amino acids 37 to 280 (244 residues), 92.6 bits, see alignment E=1.2e-29 PF13531: SBP_bac_11" amino acids 39 to 281 (243 residues), 54.4 bits, see alignment E=4e-18 PF13416: SBP_bac_8" amino acids 40 to 299 (260 residues), 122.8 bits, see alignment E=5.9e-39 PF13343: SBP_bac_6" amino acids 75 to 301 (227 residues), 82.9 bits, see alignment E=6.4e-27

Best Hits

Swiss-Prot: 49% identical to POTD_SHIFL: Spermidine/putrescine-binding periplasmic protein (potD) from Shigella flexneri

KEGG orthology group: K11069, spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to dvl:Dvul_2867)

MetaCyc: 49% identical to spermidine preferential ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FW8 at UniProt or InterPro

Protein Sequence (345 amino acids)

>DVU0095 polyamine ABC transporter, periplasmic polyamine-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQRLLATVVMLLLWTGVAVSAEPKVLNVFNWSEYVPQTVLDRFTKETGIKVVYTTYESNE
AMYAKIKLLRGKGYDIVVPSTYFIDMMRKDGLLAKIDRAKLTNYANLDPRVLHQPFDPQN
EFSVPYMWGNTGLMVNRKVVDPATISSWNDLFRPEFKGGVILSDDLRDTFGIALKALGYS
VNSTSEAEIKAAYEWLLKLKPSVRVFDVTATKQAFIAEEVKGGMSWNGDAFIAMNENPDL
AFVYPKEGLPLWVDSLAIPIGAEHKDNAHKFIDFLLRPDIAKLCVEEYNYSTPNLAAQKI
LDARHAQSRATSPTDADLKNSEFTNGVGKALDVYEKYWEMLKTAD